KEGG   Paenibacillus cellulosilyticus: HUB94_27255
Entry
HUB94_27255       CDS       T07813                                 
Name
(GenBank) NADH-quinone oxidoreductase subunit J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
pcel  Paenibacillus cellulosilyticus
Pathway
pcel00190  Oxidative phosphorylation
pcel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcel00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HUB94_27255
Enzymes [BR:pcel01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     HUB94_27255
SSDB
Motif
Pfam: Oxidored_q3 MbhD
Other DBs
NCBI-ProteinID: QKS47992
LinkDB
Position
unnamed4:complement(1831157..1831684)
AA seq 175 aa
MNGFTFNFDGGYAAFFVFAVLIIAGSVLMISTSKVVHMVMSMAAVFLGVGGMYILLDAEF
LAFVQVLIYAGAISILMIFGIMMTNHRDAAAEAVKPLKETLAAVGALALFGLLFYAIRDA
DFTGMDGGRMVPEEDNTAAIGVLLFHNQVLPFEIVSVLLTVAFIGAVVLAKKEAE
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaacggcttcacatttaatttcgacggcggatacgcagcgttcttcgtcttcgctgtg
cttattattgccggatcggtgctgatgatcagcacctcgaaggtcgttcatatggtcatg
tcgatggctgctgtgtttctaggcgtcggcggcatgtatattttgctcgatgcagagttt
ctggcgttcgtccaagtgctgatctacgcaggagcgatctcgattctaatgatcttcggc
attatgatgacgaatcatcgtgatgcggcggccgaggcggtgaagccgctgaaggagacg
ctcgcagcggttggagcgcttgcgctgttcgggctgctgttctacgcgatccgcgatgcg
gatttcacgggcatggacggcggcaggatggttccggaagaagacaatacggccgcgata
ggcgtcttgctgttccacaatcaagtattgccgttcgagatcgtatccgtgctgctgacc
gtcgcgtttatcggcgctgtcgtcttggcgaagaaggaggcggagtag

DBGET integrated database retrieval system