Polistes canadensis: 106785799 Help Entry 106785799         CDS       T05611                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pcf  Polistes canadensis Pathway pcf04013   MAPK signaling pathway - fly pcf04145   Phagosome pcf04148   Efferocytosis pcf04310   Wnt signaling pathway pcf04620   Toll-like receptor signaling pathway pcf05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pcf00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     106785799    04310 Wnt signaling pathway     106785799  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106785799    04148 Efferocytosis     106785799  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106785799  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     106785799  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcf04131]     106785799   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcf04147]     106785799    04031 GTP-binding proteins [BR:pcf04031]     106785799 Membrane trafficking [BR:pcf04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     106785799  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     106785799   Macropinocytosis    Ras GTPases     106785799  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     106785799 Exosome [BR:pcf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106785799   Exosomal proteins of other body fluids (saliva and urine)    106785799   Exosomal proteins of colorectal cancer cells    106785799   Exosomal proteins of bladder cancer cells    106785799 GTP-binding proteins [BR:pcf04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     106785799 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  106785799 NCBI-ProteinID:  XP_014602015 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggctatcaagtgcgtggttgtcggtgacggagcagtgggtaaaacgtgcctcttg ataagctatactaccaatgcattcccgggtgaatacatcccaaccgtatttgacaactat tctgcgaacgtgatggtggatggaaagcccattaacttaggtctatgggatactgctggt caagaagattatgacagattaagaccgctgtcctatccacaaacagatgtattcttgatt tgcttctctttggtaaatcctgcaagttttgagaatgttcgtgctaaatggtatccagaa gtacgtcatcactgtcctgcgactccaattattttagtaggcactaaattggatctacgt gaggacaaagaaactattgagcgtcttaaagataagaaacttgcacctattacttatcct cagggtttggcaatggcaaaagaaataggtgctgttaaatatttagaatgttccgcttta acgcaaaaaggtttgaagactgtttttgatgaagcaattcgtgctgttttatgtcctgtt cttcaggttaaaccaaaacgcagatgtttccttctataa

DBGET integrated database retrieval system