KEGG   Pseudomonas corrugata: AXG94_15195
Entry
AXG94_15195       CDS       T04842                                 
Name
(GenBank) protease modulator HflC
  KO
K04087  modulator of FtsH protease HflC
Organism
pcg  Pseudomonas corrugata
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pcg01002]
    AXG94_15195
Peptidases and inhibitors [BR:pcg01002]
 Peptidase inhibitors
  Family I87
   AXG94_15195
SSDB
Motif
Pfam: Band_7 DivIVA
Other DBs
NCBI-ProteinID: AOE63051
LinkDB
Position
complement(3505728..3506768)
AA seq 346 aa
MSQSSSHDHHDHTHHDHGHAGHHHGHHHHHHGDPQEAGPFPWRRMGWAALLVAFAVAAAS
LVQVRSGEATVITRFGNPARVLLQPGLGWRWPTPFEAAIPVDLRLRTTSSGLQDVGTRDG
LRIIVQAYVAWQVQGDPANVQRFMRAVQNQPDEAARQIRTFVGSALETTAASFDLANLVN
TDASQVRIDDFEAQLRQQIEQQLLATYGVRVLQVGIERLTLPSVTLTATVDRMRAERETI
ATERTAIGKREAAQIRSAAERDARIVQADATVKAADIEAQSRVEAAEIYGKAYAGSPQLY
NLLRSLDTLGTIVSPATKLILRTDAAPFRVLVDGPPSVELKGGTQP
NT seq 1041 nt   +upstreamnt  +downstreamnt
ttgagccagtcttcttcccacgatcatcacgatcatacccatcatgaccacggccatgcc
ggtcaccatcatgggcatcatcaccatcatcacggcgacccgcaggaagcgggtccattt
ccctggcggcgaatgggctgggcggcgctgctggtcgcctttgccgtcgcggccgcgagc
ctggtccaggtgcgctcgggggaggcgaccgtcatcacccgctttggcaatccggcacgg
gtacttttgcagcctggcctgggttggcgctggccgacgccgttcgaggcagcgattccg
gtggacttgcgactgcgcacgacctccagcggtctgcaggatgtcggtacccgtgacggc
ttgcgcatcattgttcaggcctacgtagcgtggcaggtgcagggtgatccggccaacgtc
cagcgtttcatgcgtgcggtgcagaaccaaccggacgaggccgcccgacagattcgcacg
ttcgtgggatcagccctggaaaccacggctgccagttttgacctggcgaatctggtcaac
accgacgccagccaagtgcgcattgacgatttcgaagcgcagctgcgccagcagatcgaa
cagcagttgctcgccacttatggcgtgcgagtgctgcaagtgggcatcgagcgtctgacc
ttgccttcggtgacgttgaccgcgacggtggatcgcatgcgtgccgagcgggaaaccatc
gccaccgaacgcaccgccattggtaagcgcgaagcggcgcaaattcgttccgccgctgaa
cgggatgcgcggatcgtgcaggcggatgccacggtgaaagccgccgatatcgaggctcag
tcccgggtcgaggccgctgaaatctatggcaaggcctacgccggttcgcctcagctgtat
aacctgctgcgctcgctggacaccttgggcacgattgtcagccccgctaccaagttgatc
ttgcgcaccgatgcagcgccattccgggtgttggtcgatggaccaccgtccgtggaactc
aaaggtggaacacaaccatga

DBGET integrated database retrieval system