Pseudomonas corrugata: AXG94_17485 Help Entry AXG94_17485       CDS       T04842                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcg  Pseudomonas corrugata Pathway pcg01100   Metabolic pathways pcg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AXG94_17485    00074 Mycolic acid biosynthesis     AXG94_17485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AXG94_17485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOE63477 UniProt:  A0A3M3EIH4 LinkDB All DBs Position complement(4030259..4030516) Genome browser AA seq 85 aa AA seqDB search MSDLHRDIKQLIIDALGLEDIEVDDIGDHQTLFGEGLGLDSVDALELGLAIQKQYGIKID ADAKDTRNHFSNVASLAAFVTAKRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccgtgacatcaaacagctgatcatcgacgccctcggcctggaggac atcgaggtcgacgatatcggtgatcaccagaccctgttcggtgaaggcctgggcctggac tctgtggatgccctggagcttggcctggcgatccagaaacagtacggcatcaagatagat gccgacgccaaggacacccgcaaccatttcagcaacgtggcaagccttgcggccttcgtc actgcaaaacgcgcttga

DBGET integrated database retrieval system