Pseudomonas corrugata: AXG94_25105 Help Entry AXG94_25105       CDS       T04842                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pcg  Pseudomonas corrugata Brite KEGG Orthology (KO) [BR:pcg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pcg03032]     AXG94_25105    03036 Chromosome and associated proteins [BR:pcg03036]     AXG94_25105    03400 DNA repair and recombination proteins [BR:pcg03400]     AXG94_25105 DNA replication proteins [BR:pcg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AXG94_25105 Chromosome and associated proteins [BR:pcg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AXG94_25105 DNA repair and recombination proteins [BR:pcg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AXG94_25105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 Barstar Motif Other DBs NCBI-ProteinID:  AOE64911 UniProt:  A0A3M3F0U8 LinkDB All DBs Position 5734346..5734618 Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAASADIPKAAAGRALDAVIESVTGALKAGDSVVLVGFGTFSVTDRPARTG RNPQTGQALQIAAAKKPGFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtcggaactgattgatgctatcgctgcatccgctgatatcccgaaagctgct gctggccgcgcgctggacgctgtaatcgaatccgtcactggcgctctcaaggctggcgac tccgttgttctggttggtttcggtaccttctccgttaccgatcgtccagctcgtaccggc cgcaacccgcaaactggccaggcactgcagatcgctgctgccaagaagccaggcttcaag gctggtaaagcactgaaagacgccgttaactaa

DBGET integrated database retrieval system