Pseudomonas chlororaphis PA23: EY04_01760 Help Entry EY04_01760        CDS       T03201                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pch  Pseudomonas chlororaphis PA23 Pathway pch01100   Metabolic pathways pch01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pch00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EY04_01760    00074 Mycolic acid biosynthesis     EY04_01760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EY04_01760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIC17640 UniProt:  A0A0E1DXF9 LinkDB All DBs Position complement(415801..416061) Genome browser AA seq 86 aa AA seqDB search MSDLHQEIKMLIIDALGLEDISVQDIGNEQTLFGEGLGLDSVDALELGLAIQKRYGIKID ADAKDTRNHFTNVASLAAFVTAKQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccaggaaattaaaatgctgatcatcgatgccctgggcctcgaagac atcagcgtgcaagacatcggcaacgagcagacgctcttcggtgaaggcctgggcctggac tcggtcgacgccctggagttgggcctggcgatccagaaacgctacggcatcaagatcgac gccgacgccaaggacacccgcaaccacttcaccaacgtggcgagccttgcggcgttcgtc actgcaaaacaggcagcttga

DBGET integrated database retrieval system