Pseudomonas chlororaphis PA23: EY04_05320 Help Entry EY04_05320        CDS       T03201                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pch  Pseudomonas chlororaphis PA23 Brite KEGG Orthology (KO) [BR:pch00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pch03036]     EY04_05320 Chromosome and associated proteins [BR:pch03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     EY04_05320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC Mod_r YabA HALZ ACCA_BT NRBF2 Motif Other DBs NCBI-ProteinID:  AIC18327 UniProt:  A0A0E1E4F9 LinkDB All DBs Position 1220277..1220555 Genome browser AA seq 92 aa AA seqDB search MRSPNWLFLVLLLLLAGLQYRLWVGNGSLAQVTDLTQQIADQRAENERLLERNRVLDAEV MELKKGMETVEERARHELGMVKEGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtcccaattggttgttcctcgtcttgctcttgctgctggctggcctgcagtac cgcctctgggtggggaatggcagcttggcgcaggtaaccgacctgactcagcaaattgcc gatcagcgcgctgaaaacgagcgcctgctggagcgcaatcgtgtactcgacgcggaagtc atggaattgaagaaaggcatggagaccgtggaagagcgggctcgtcatgaactgggcatg gtcaaggagggcgaaaccctctaccagttggcccaatga

DBGET integrated database retrieval system