Pseudomonas chlororaphis PA23: EY04_08580 Help Entry EY04_08580        CDS       T03201                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pch  Pseudomonas chlororaphis PA23 Pathway pch01100   Metabolic pathways pch01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pch00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EY04_08580    00074 Mycolic acid biosynthesis     EY04_08580   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EY04_08580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AIC18951 UniProt:  A0A068AK11 LinkDB All DBs Position 1906655..1906891 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgctgagcaactgggcgttaaggaa gaagaagttgttaacaccgcttccttcgttgaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gaaaagatcactaccgttcaagcagctatcgactacgttaccagccaccaggcttaa

DBGET integrated database retrieval system