Pseudomonas chlororaphis PA23: EY04_18590 Help Entry EY04_18590        CDS       T03201                                  Name (GenBank) peptidylprolyl isomerase   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism pch  Pseudomonas chlororaphis PA23 Brite KEGG Orthology (KO) [BR:pch00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pch03110]     EY04_18590 Enzymes [BR:pch01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      EY04_18590 Chaperones and folding catalysts [BR:pch03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     EY04_18590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase Rotamase_3 Rotamase_2 Mtf2_C Motif Other DBs NCBI-ProteinID:  AIC20841 UniProt:  A0A0D5XY04 LinkDB All DBs Position 4105162..4105437 Genome browser AA seq 91 aa AA seqDB search MKAQARHILVKTAEEAEQLKQRIAKGEAFDVLAKKYSTCPSGKRGGDLGEVRPGQMVGAI DQVIFKKPLRTVHGPIKSKFGYHLVQVFYRD NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaagcccaagcccgccacatcctggtgaaaaccgccgaagaggccgaacagctcaag cagcgcatcgccaagggcgaagccttcgacgtgctggcgaagaagtactccacctgcccc tccggcaaacgcggcggcgacctgggtgaagtacggccggggcagatggtcggggccatc gaccaggtgatcttcaaaaagcccctgcgcaccgtgcacgggccgatcaaaagcaagttc ggttatcacctggtgcaggtgttctaccgcgactga

DBGET integrated database retrieval system