Pseudomonas chlororaphis PA23: EY04_20825 Help Entry EY04_20825        CDS       T03201                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pch  Pseudomonas chlororaphis PA23 Pathway pch01100   Metabolic pathways pch01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pch00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EY04_20825   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EY04_20825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AIC21262 UniProt:  A0A7S5HRL7 LinkDB All DBs Position complement(4633389..4633640) Genome browser AA seq 83 aa AA seqDB search METLEQRVKRVVASELAVDLAQIGNQDSFVGNLGADSLARVELVTALETEFELTIPDDQA DSLQTVQQVIDYLRQASEQAAPA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggaaaccctcgagcaacgtgtgaaaagagtggtggcgagcgaactggccgtcgacctg gcacagatcggcaaccaggactcgttcgtcgggaacctgggagcggactcgctggcccgg gtggaactggtgacggccctggagaccgagttcgaactcaccatcccggacgaccaagcc gatagcctgcagaccgtgcagcaggtgatcgactacctccgacaggccagtgagcaagca gccccggcctga

DBGET integrated database retrieval system