KEGG   Pseudomonas chlororaphis PA23: EY04_24150
Entry
EY04_24150        CDS       T03201                                 
Name
(GenBank) nickel ABC transporter permease
  KO
K02034  peptide/nickel transport system permease protein
Organism
pch  Pseudomonas chlororaphis PA23
Pathway
pch02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pch00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EY04_24150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pch02000]
    EY04_24150
Transporters [BR:pch02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    EY04_24150
SSDB
Motif
Pfam: BPD_transp_1 OppC_N
Other DBs
NCBI-ProteinID: AIC21889
LinkDB
Position
complement(5334122..5334973)
AA seq 283 aa
MSGQLMLAGWRPRFRVRNGRLTTVSGLAIVLGWLVLALLAPWVAPFDPIAQNTDIRLLGP
SLMHPFGTDNFGRDILSRVIWGARIDLQISLIGVIFPFLIGTCVGALAGYIGGRFDTLCM
RLIDIILAFPFLVLMLAIMAILGPGLSSFYIAMALVGWVSYARLIRSQILVLKESDFALA
AKSLGFGHGRILFRHLLPNAMFGSIVFAMSDAVLVLLNGAAVSYLGLGVQPPTAEWGTMV
AEGQSFITSAWWICTFPGLAIVTLAMGFSLLADGIAERLGERL
NT seq 852 nt   +upstreamnt  +downstreamnt
atgagtggccagctcatgctcgcgggttggcgcccgcgcttccgtgtgcgcaacggccgc
ctgactactgtgtcgggcctggcaatcgtgctgggttggctggtgctggcgctcctcgcg
ccctgggtcgcgccttttgatccgatcgcccagaacaccgatatccgtctgttgggaccg
agcctgatgcatccgttcggcacggataattttggccgcgatattctttcccgagtgatt
tggggagctcgaatcgatttgcagatatcccttatcggggtgatcttccctttcctgatc
ggcacctgcgtcggcgctctggctggctatatcggtgggcgcttcgacacgctctgcatg
cgcctgatcgatatcatcctggccttcccctttctggtgctgatgctggcgatcatggcc
attctcggccccggcctgagcagtttctacattgccatggccctggtgggctgggtgtcc
tatgcacggctgatccgctcacagatcctggtgctcaaggaaagcgatttcgccctggcg
gcgaaaagcctgggttttggccatgggcgcattctgttccgacatctgctgcccaacgcc
atgttcggctcgatcgtgtttgccatgtccgacgcggtgctggtgttgctcaatggtgcg
gcggtcagctacctaggcctgggggttcagccgcccaccgccgagtggggcacgatggtc
gccgaaggccagagtttcattaccagcgcctggtggatctgcaccttcccggggttggcg
attgtcaccctggccatgggcttcagcctgctggccgatggtatcgccgaacgcctcgga
gagcgcttatga

DBGET integrated database retrieval system