Ectopseudomonas chengduensis: QYM18_15940 Help Entry QYM18_15940       CDS       T09586                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pche  Ectopseudomonas chengduensis Pathway pche01100   Metabolic pathways pche01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pche00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QYM18_15940 (acpP)    00074 Mycolic acid biosynthesis     QYM18_15940 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QYM18_15940 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WKC35958 LinkDB All DBs Position 3402243..3402479 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYVTAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgctgagcaacttggcgtcaaggaa gaggaagtaaccaacagcgcttccttcgttgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctcgaggaagaattcgagaccgagatcccggacgagcaagct gagaaaatcaccaccgttcaagaagctatcgactacgtgactgcccacgcgcaataa

DBGET integrated database retrieval system