Paenibacillus chitinolyticus: PC41400_06640 Help Entry PC41400_06640     CDS       T06610                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pchi  Paenibacillus chitinolyticus Pathway pchi00998   Biosynthesis of various antibiotics pchi01100   Metabolic pathways pchi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pchi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PC41400_06640    00074 Mycolic acid biosynthesis     PC41400_06640   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PC41400_06640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QAV17357 UniProt:  A0A410WSY3 LinkDB All DBs Position 1459192..1459455 Genome browser AA seq 87 aa AA seqDB search MNVKAVKSRIIEVTVSLLDSTEPVEELDADAFLRKPLPEIGIDSLAVLELVVTLEREFGV RMTEDDLGGIATLEDILTFITGRAGQS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaacgttaaagctgtgaaatcccgcattatcgaagtaacggtgagtcttctggattct acggagccggtggaagaattggacgccgacgctttcctgcggaaacccctgcccgaaatc ggaattgattctttggctgtcctggaacttgtggttaccctggaaagagaattcggcgtg agaatgacggaggacgatctcggcggcatcgcgacactggaggatattctgacctttatt acaggcagggcgggacaaagctga

DBGET integrated database retrieval system