Paenibacillus chitinolyticus: PC41400_16220 Help Entry PC41400_16220     CDS       T06610                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pchi  Paenibacillus chitinolyticus Pathway pchi00998   Biosynthesis of various antibiotics pchi01100   Metabolic pathways pchi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pchi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PC41400_16220   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PC41400_16220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding FtsH_ext Motif Other DBs NCBI-ProteinID:  QAV19139 UniProt:  A0A410WXH4 LinkDB All DBs Position 3538805..3539065 Genome browser AA seq 86 aa AA seqDB search MTKEDVYAKFVEHIKKTNQVEELQIDENDNLLEHGYIDSLSMVDMIVFLEEQVGREIVIE DYDIRKFYTLKSIYETFFQDHLVSSN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgactaaagaagacgtgtatgcaaaatttgtggagcacatcaaaaaaacgaatcaggtg gaagaactgcagatcgacgagaacgataatctgctggagcacggttatatcgactccttg tcgatggtggatatgattgtgtttctggaggaacaggtcggacgcgaaatcgtgatcgaa gattatgatatccgcaagttttatacgctgaaatcgatttacgaaaccttcttccaagat cacctggtttcctccaattga

DBGET integrated database retrieval system