Stutzerimonas chloritidismutans: LLJ08_07485 Help Entry LLJ08_07485       CDS       T07923                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pchl  Stutzerimonas chloritidismutans Pathway pchl01100   Metabolic pathways pchl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pchl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LLJ08_07485 (acpP)    00074 Mycolic acid biosynthesis     LLJ08_07485 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LLJ08_07485 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  UEG62966 LinkDB All DBs Position 1600545..1600781 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcaacttggcgttaaagaa gaggaagtaaccaacagcgcttccttcgtcgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgagatcccggacgagcaagct gagaagatcaccaccgttcaggaagccatcgattacatcaacgcgcacgcgcagtaa

DBGET integrated database retrieval system