Stutzerimonas chloritidismutans: LLJ08_14145 Help Entry LLJ08_14145       CDS       T07923                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pchl  Stutzerimonas chloritidismutans Pathway pchl01100   Metabolic pathways pchl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pchl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LLJ08_14145    00074 Mycolic acid biosynthesis     LLJ08_14145   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LLJ08_14145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UEG60272 LinkDB All DBs Position 3062173..3062421 Genome browser AA seq 82 aa AA seqDB search MNEKEILQALTQVFHDVFDDDDIVLTSETTADDIDGWDSQTHVLLIVAAEQRFGIKFRTA ELESLKNVGHFAQLIQTKLGGR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaacgaaaaggaaattctccaggcgctgacccaggtcttccacgacgtgttcgacgat gacgatatcgtcctcacctccgaaaccaccgccgacgacatcgatggctgggacagccag acccatgtgctgctgatcgtggccgccgagcaacgcttcggcatcaagttccgcaccgcc gaactggaatcgctgaagaacgttggccacttcgcgcaactgatccagaccaaactcgga gggcgttga

DBGET integrated database retrieval system