Pochonia chlamydosporia: VFPPC_14157 Help Entry VFPPC_14157       CDS       T09407                                  Name (RefSeq) UDP-glucose 4-epimerase Gal10   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism pchm  Pochonia chlamydosporia Pathway pchm03020   RNA polymerase pchm03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pchm00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     VFPPC_14157   09124 Replication and repair    03420 Nucleotide excision repair     VFPPC_14157  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pchm03021]     VFPPC_14157    03400 DNA repair and recombination proteins [BR:pchm03400]     VFPPC_14157 Transcription machinery [BR:pchm03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      VFPPC_14157   RNA polymerase III system    RNA polymerase III      VFPPC_14157   RNA polymerase I system    RNA polymerase I      VFPPC_14157 DNA repair and recombination proteins [BR:pchm03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       VFPPC_14157 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG DpnD_N Motif Other DBs NCBI-GeneID:  28855921 NCBI-ProteinID:  XP_018139958 UniProt:  A0A179F9W2 LinkDB All DBs Position 7:709373..709951 Genome browser AA seq 150 aa AA seqDB search MSSGGGDATLFEESFTVTDYDQSKYDRVARISCTSADSQTVMVLDINMELFPCAVSDSLH VVLSTTLSPDGSKEDDKGWRDVGKGGDAPSTMADLYDYVCYGKIYKFEETYDGNTINAYV SFGGLLMSLQGPIKKLTPLRVDNVYLLIKK NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtccagcgggggcggtgatgctacactttttgaggagagtttcacggtgaccgactat gaccaatccaagtatgatcgggttgctcgtatatcgtgcacatcagccgactcgcaaacg gtaatggtgctggatatcaacatggagctctttccctgtgccgtgtccgattccctacat gttgtcctctccacaaccttatctccggatggtagtaaggaggatgataagggctggcga gatgttggcaagggaggagatgcaccatccacgatggcggacttgtatgactatgtttgt tatggcaaaatctacaaatttgaagaaacatatgatggcaacacaatcaatgcatacgtc tccttcggcggccttctcatgtcgctgcagggtcctattaagaagctcacccctctacgt gtcgacaacgtttatctcctcataaagaaataa

DBGET integrated database retrieval system