Penaeus chinensis (fleshy prawn): 125027935 Help Entry 125027935         CDS       T08118                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism pchn  Penaeus chinensis (fleshy prawn) Pathway pchn04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pchn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     125027935  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pchn04121]     125027935    03400 DNA repair and recombination proteins [BR:pchn03400]     125027935 Ubiquitin system [BR:pchn04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      125027935    Cul5 complex      125027935 DNA repair and recombination proteins [BR:pchn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      125027935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Dehyd-heme_bind Rad60-SLD Ubiquitin_2 Ubiquitin_4 Motif Other DBs NCBI-GeneID:  125027935 NCBI-ProteinID:  XP_047473061 LinkDB All DBs Position 8:39439261..39450375 Genome browser AA seq 117 aa AA seqDB search MDVFLMVRRKKTTIFTDAKETTTVRELKKIIQGIMKVEPENQQLMNERGTEIFDDDKQLS DYNLSAQTARAQSPATVALVFRQENGDFEPLDITPLSSPPELPEVMKPQEPQTHDLN NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttttgatggtacggaggaagaagactacaatcttcacagatgccaaggaa acaacaacagtcagggagttaaagaaaataatacaaggaattatgaaagttgaacccgag aaccagcagctaatgaacgaacgtgggacagaaatattcgacgatgacaaacagctcagc gactacaatctatcggcccagacagcacgagctcagagtcctgctactgttgcacttgta tttaggcaggaaaatggagattttgagccacttgatatcacacctttatcatccccccct gagctgcccgaagtgatgaaacctcaggaacctcaaactcacgaccttaattga

DBGET integrated database retrieval system