Penaeus chinensis (fleshy prawn): 125038275 Help Entry 125038275         CDS       T08118                                  Name (RefSeq) eclosion hormone-like   KO K28249   eclosion hormone Organism pchn  Penaeus chinensis (fleshy prawn) Brite KEGG Orthology (KO) [BR:pchn00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pchn04052]     125038275 Cytokines and neuropeptides [BR:pchn04052]  Neuropeptides   Unclassified    125038275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Eclosion Insulin_TMD Motif Other DBs NCBI-GeneID:  125038275 NCBI-ProteinID:  XP_047487682 LinkDB All DBs Position 24:9176982..9190585 Genome browser AA seq 82 aa AA seqDB search MSVKAQVRVVVASVVCLVLLAAVCDGASITSMCIRNCGQCKEMYGDYFHGQACAESCIMT QGMSIPDCNNPSTFNRFLKRFI NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtccgtcaaggcccaggtccgcgtggtggtggcgagtgtggtgtgcttggtgctgctg gctgccgtgtgcgacggagcctccatcaccagtatgtgcatcaggaactgcgggcagtgc aaggaaatgtacggcgactacttccacgggcaggcctgcgccgagtcctgcatcatgacg cagggcatgagcatccccgactgcaacaacccctccaccttcaatcgcttcctcaagagg ttcatctaa

DBGET integrated database retrieval system