Penaeus chinensis (fleshy prawn): 125048252 Help Entry 125048252         CDS       T08118                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism pchn  Penaeus chinensis (fleshy prawn) Pathway pchn04137   Mitophagy - animal pchn04140   Autophagy - animal pchn04144   Endocytosis pchn04145   Phagosome pchn04148   Efferocytosis Brite KEGG Orthology (KO) [BR:pchn00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     125048252    04145 Phagosome     125048252    04140 Autophagy - animal     125048252    04137 Mitophagy - animal     125048252    04148 Efferocytosis     125048252  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pchn04131]     125048252   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pchn04147]     125048252    04031 GTP-binding proteins [BR:pchn04031]     125048252 Membrane trafficking [BR:pchn04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     125048252 Exosome [BR:pchn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125048252   Exosomal proteins of other body fluids (saliva and urine)    125048252   Exosomal proteins of colorectal cancer cells    125048252   Exosomal proteins of bladder cancer cells    125048252 GTP-binding proteins [BR:pchn04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     125048252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin PduV-EutP AAA_16 NTPase_1 AAA_24 NACHT AAA_7 AAA_22 ATPase_2 G-alpha AAA_5 SRPRB TniB PRK AAA_14 NB-ARC ATP-synt_ab RNA_helicase ABC_tran Motif Other DBs NCBI-GeneID:  125048252 NCBI-ProteinID:  XP_047502818 LinkDB All DBs Position 43:20597363..20624666 Genome browser AA seq 205 aa AA seqDB search MASRKKILLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTSPNTFKSLDSWRDEFLIQASPRDPDHFPF VVLGNKIDLENRAVSTKRAQQWCHSKNEVPYFETSAKEAINVELAFQTIARNALAQESEV ELYNEFPDQIKLTNDNKAKQDACSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcatctcgcaagaagattctcctgaaggtgatcatcctgggagactctggtgtaggc aaaacatcccttatgaaccagtttgttaacaagaaattcagcaaccagtacaaggcaacc attggggcagatttcctcacaaaggaggttatggttgatgatagattggtcacaatgcag atctgggatacagctggtcaagagagattccagtcattaggtgttgcattctatcgagga gctgattgttgtgttctcgtttatgatgttacatctcccaacaccttcaagtctctcgat tcatggcgtgacgagtttctaattcaagcctcaccaagggaccctgatcacttcccattt gttgttctgggtaacaagattgatctggagaatagggcggtatcgacgaagcgagcacaa caatggtgtcatagtaaaaatgaagttccctactttgaaactagtgcaaaggaagccatt aacgtggagttagccttccagaccattgctcgcaatgctcttgctcaggaatctgaggtg gagctctacaatgagtttccagaccagatcaaattgaccaatgacaacaaggctaaacag gatgcgtgctcttgctaa

DBGET integrated database retrieval system