Pseudomonas chlororaphis subsp. piscium: C4K32_1882 Help Entry C4K32_1882        CDS       T09060                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pchp  Pseudomonas chlororaphis subsp. piscium Pathway pchp01100   Metabolic pathways pchp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pchp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C4K32_1882    00074 Mycolic acid biosynthesis     C4K32_1882   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C4K32_1882 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AZC68555 LinkDB All DBs Position 2017208..2017444 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgctgagcaactgggcgttaaagaa gaagaagttgttaacaccgcttccttcgttgaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gaaaagatcactaccgttcaagcagctatcgactacgttaccagccaccaggcttaa

DBGET integrated database retrieval system