Pseudomonas cichorii: PCH70_04150 Help Entry PCH70_04150       CDS       T03002                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pci  Pseudomonas cichorii Pathway pci00998   Biosynthesis of various antibiotics pci01100   Metabolic pathways pci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pci00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PCH70_04150    00074 Mycolic acid biosynthesis     PCH70_04150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PCH70_04150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AHF65568 LinkDB All DBs Position complement(436615..436869) Genome browser AA seq 84 aa AA seqDB search MQTREDIFETLRASMVELFELEPERVTLQANLYQELEIDSIDAVDLIDHIKRKTGKKIAA EEFKSVRTVNDVVEAVYRMTNPAE NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgcgaagacattttcgagaccctgcgtgcgtccatggtcgagttgttcgag cttgagccggagcgcgtcaccctgcaagccaacctgtatcaggagctggaaatcgacagc atcgatgccgtagacctgatcgaccacatcaaacgcaagaccggcaagaaaatcgccgca gaagagttcaagtcggtaagaacggtcaacgatgtagtcgaagccgtctatcgcatgacc aatccagccgaatga

DBGET integrated database retrieval system