Pseudomonas cichorii: PCH70_04160 Help Entry PCH70_04160       CDS       T03002                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism pci  Pseudomonas cichorii Pathway pci00998   Biosynthesis of various antibiotics pci01100   Metabolic pathways pci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pci00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PCH70_04160    00074 Mycolic acid biosynthesis     PCH70_04160   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PCH70_04160 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AHF65569 LinkDB All DBs Position complement(436879..437139) Genome browser AA seq 86 aa AA seqDB search MSDLHRDIKQLIIDALGLEDITPHDIGNDQILFGEGLGLDSVDALELGLAIQKRYGIKID ADAKDTRNHFTCVDSLAAFVSARQSA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctacaccgggacattaagcaactgatcatcgatgccctgggcctcgaagac atcaccccacacgacataggcaacgaccagattctctttggcgaaggcctgggactggac tcggtcgatgcgctggaactggggctggcgattcagaagcgctacggcatcaagatcgat gccgatgcaaaagacactcgcaatcacttcacctgcgtggacagccttgcggccttcgtc agcgccagacaatcggcctga

DBGET integrated database retrieval system