Proteus terrae subsp. cibarius: F9282_11900 Help Entry F9282_11900       CDS       T06330                                  Symbol flgM Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pcib  Proteus terrae subsp. cibarius Pathway pcib02020   Two-component system pcib02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pcib00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     F9282_11900 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     F9282_11900 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pcib02035]     F9282_11900 (flgM) Bacterial motility proteins [BR:pcib02035]  Flagellar system   Flagellar assembly proteins    Others     F9282_11900 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QGW03657 LinkDB All DBs Position 2480442..2480741 Genome browser AA seq 99 aa AA seqDB search MSIERANPLLPINAIAQRNPSEVTQGSRKSGTTEQKTATGDTSVKLSEAQKKLVQPGNKD IDVEKVARLKEAIANGTLTMDSGKIADALFREAAESITQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagtattgaacgcgcgaatccactgcttccgattaacgcaattgcacaacgtaaccca agtgaagtcacacagggttcacgtaaatcgggaacaactgaacaaaaaactgcaacaggc gacacttctgtaaaactaagtgaagcgcagaaaaaacttgttcaacctggaaataaagac attgacgttgagaaagttgctcgcttaaaagaagcaattgccaacggcacattaaccatg gacagcggtaaaattgcggacgctcttttccgtgaagctgctgaaagcataactcaataa

DBGET integrated database retrieval system