Prosopis cineraria: 129312180 Help Entry 129312180         CDS       T09047                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism pcin  Prosopis cineraria Pathway pcin03083   Polycomb repressive complex pcin04120   Ubiquitin mediated proteolysis pcin04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pcin00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     129312180    04120 Ubiquitin mediated proteolysis     129312180   09126 Chromosome    03083 Polycomb repressive complex     129312180  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcin04131]     129312180    04121 Ubiquitin system [BR:pcin04121]     129312180    03036 Chromosome and associated proteins [BR:pcin03036]     129312180 Membrane trafficking [BR:pcin04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     129312180 Ubiquitin system [BR:pcin04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      129312180    Cul7 complex      129312180 Chromosome and associated proteins [BR:pcin03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      129312180   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      129312180 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 DUF808 Motif Other DBs NCBI-GeneID:  129312180 NCBI-ProteinID:  XP_054810779 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MSSRKITLKSSDLESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK KHVEAASSEEKTSDEDIKAWDAEFVRVDQAVLFDLILAANYLNIKSLLDLTCQTVAGMIK GKTPEEIRKTFSIKNDFTPEEEEEVRRENQWAFE NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgaggaaaattactttgaagagctccgatctcgaatcctttgaagtcgatgag gccgtggcgcttgagtcgcagacgatcaagcacatgatcgaggacgattgtgccgacaac ggcatccctctgcccaacgtgaccagtaagatcttagccaaggtaatcgaatactgcaag aagcacgtcgaagccgctagttccgaggagaagacctccgacgaagatatcaaggcttgg gatgctgaattcgtgagggttgaccaggctgtgctgtttgatctcattttggcagctaac tacttgaatatcaagagcttgctggatctgacttgtcagactgtggcaggcatgatcaag gggaagacaccagaggagattcgtaagacctttagtatcaagaatgattttacccctgag gaagaggaggaagtccgtcgggaaaaccaatgggcatttgaataa

DBGET integrated database retrieval system