KEGG   Paraburkholderia caledonica: CUJ87_23590
Entry
CUJ87_23590       CDS       T05740                                 
Name
(GenBank) DNA-binding response regulator
  KO
K07689  two-component system, NarL family, invasion response regulator UvrY
Organism
pcj  Paraburkholderia caledonica
Pathway
pcj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CUJ87_23590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pcj02022]
    CUJ87_23590
Two-component system [BR:pcj02022]
 NarL family
  BarA-UvrY (central carbon metabolism)
   CUJ87_23590
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 Terminase_5 HTH_28 Sigma70_r4 HTH_40 Sigma70_ECF HTH_38 DUF6783 HTH_29 HTH_50 HTH_24 HTH_7
Other DBs
NCBI-ProteinID: AXF17292
LinkDB
Position
PHRS4_B:1362333..1362995
AA seq 220 aa
MAGADISVLLVDDHAVVREGYRRLLEVNADVHVCGEAADATLAYQRFCALRPDVVVMDVS
LPGASGIEAMRRMLAREPDARVLIFSVHEEAIFVRRALDAGALGYVTKASAPDVLVEAVR
TIARRVSYLSPDISQALALRNAFSEGPPGRQLSAREFEVLRLLVQGYTLPSIAEKLGLSQ
KTVANHQSVIRQKFGADNGVQLAQMASRLGLQFTGSASPA
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcaggggcggacatttcagtgttgctcgtcgacgatcacgccgtggtgcgcgaaggc
taccggcgtcttctcgaagtgaacgccgacgtgcacgtgtgcggcgaggcggccgacgcc
accctcgcctatcagcgcttttgtgcgttgcggcccgatgtcgtcgtgatggacgtgtcg
ctgccgggagcaagcggcatcgaggcgatgcggcgcatgctcgcgcgcgagcccgatgcc
cgggtgctgattttcagcgtgcatgaagaagcgattttcgtgcgccgcgcgctcgacgcc
ggcgcgctcggctatgtgaccaaggccagcgctcccgatgtgctcgtggaagcggttcgc
acgatcgcgaggcgcgtgagctatctgagccctgacatctcgcaggcgctcgcactgcgc
aacgccttcagcgaaggcccgcctgggcggcagttatccgcgcgtgaattcgaagtgctg
cgtctgctcgtacagggttacacgctgccgagcatcgccgaaaaactcggtcttagccag
aagacggtggccaatcatcagtcggtgatccggcagaagttcggtgccgacaacggtgtt
caactcgcgcaaatggcaagccgcctcggtcttcagttcaccggttcggcgagtcccgcc
tga

DBGET integrated database retrieval system