Pyrobaculum calidifontis: Pcal_0307 Help Entry Pcal_0307         CDS       T00483                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism pcl  Pyrobaculum calidifontis Pathway pcl03010   Ribosome Brite KEGG Orthology (KO) [BR:pcl00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Pcal_0307   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Pcal_0307  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pcl03011]     Pcal_0307    04121 Ubiquitin system [BR:pcl04121]     Pcal_0307   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcl04147]     Pcal_0307 Ribosome [BR:pcl03011]  Ribosomal proteins   Eukaryotes    Small subunit     Pcal_0307   Archaea     Pcal_0307 Ubiquitin system [BR:pcl04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Pcal_0307 Exosome [BR:pcl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Pcal_0307   Exosomal proteins of colorectal cancer cells    Pcal_0307 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Zn_ribbon_Nudix Zn_ribbon_IS1595 Zn_ribbon_SprT Ribosomal_L37ae EDR4-like_1st DUF1451 Zn_ribbon_3 Zn_ribbon_TFIIB zf-C2H2_ZN142 Zn_Ribbon_1 YhfH Zn_Ribbon_TF Motif Other DBs NCBI-ProteinID:  ABO07742 UniProt:  A3MSX5 LinkDB All DBs Position 297593..297790 Genome browser AA seq 65 aa AA seqDB search MSKKAPAKEGKKLPRAATWYEIDMEKGVFRFKNKLCPKCGSVMAFHREPVPRWHCGKCGF TQFQR NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgtctaagaaggcgcctgccaaagagggtaagaagctgccccgcgcggcgacttggtac gagattgacatggagaagggggtgtttaggtttaagaacaagctctgccccaagtgtggc tctgtcatggccttccaccgcgagcccgtgccgcgttggcactgcggtaagtgtggtttt actcagttccagaggtga

DBGET integrated database retrieval system