Pyrobaculum calidifontis: Pcal_1754 Help Entry Pcal_1754         CDS       T00483                                  Name (GenBank) hypothetical protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism pcl  Pyrobaculum calidifontis Pathway pcl00290   Valine, leucine and isoleucine biosynthesis pcl00650   Butanoate metabolism pcl00660   C5-Branched dibasic acid metabolism pcl00770   Pantothenate and CoA biosynthesis pcl01100   Metabolic pathways pcl01110   Biosynthesis of secondary metabolites pcl01210   2-Oxocarboxylic acid metabolism pcl01230   Biosynthesis of amino acids Module pcl_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine pcl_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:pcl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     Pcal_1754    00660 C5-Branched dibasic acid metabolism     Pcal_1754   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     Pcal_1754   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     Pcal_1754 Enzymes [BR:pcl01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      Pcal_1754 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  ABO09171 UniProt:  A3MX04 LinkDB All DBs Position 1630844..1631098 Genome browser AA seq 84 aa AA seqDB search MNTIKLKISQSMDSVGRVISIVRRAKVSVKRLELVSTDSLYEVEMYVEGAADEVQWLVAK LDKLPEVLEIKTAPIITATAIVSR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaacacaattaagctaaagatatcccaatcaatggacagcgtcggaagagtcatcagc atagttagaagggccaaggtcagcgtaaagagactagagctagtctccacagactcccta tacgaagttgagatgtatgtagaaggcgccgcagacgaggtgcagtggctggttgcaaag ttggacaagttgccagaggtgctagagatcaaaacggcgcccataattacggcaacggcg atagtcagtaggtaa

DBGET integrated database retrieval system