Pedobacter cryoconitis: AY601_0824 Help Entry AY601_0824        CDS       T04341                                  Name (GenBank) Exonuclease VII small subunit   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism pcm  Pedobacter cryoconitis Pathway pcm03430   Mismatch repair Brite KEGG Orthology (KO) [BR:pcm00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     AY601_0824  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pcm03400]     AY601_0824 Enzymes [BR:pcm01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      AY601_0824 DNA repair and recombination proteins [BR:pcm03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      AY601_0824 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S PBSX_XtrA CENP-Q DUF4088 DUF7179 DUF16 Nuf2_DHR10-like Motif Other DBs NCBI-ProteinID:  AMP97765 UniProt:  A0A127V926 LinkDB All DBs Position 954868..955074 Genome browser AA seq 68 aa AA seqDB search MEKNLNYEAAYSELTQIAQEIETEAVSVDVLAEKVKRASELIAFCQTKLRSTETEVNKII KQMENQPL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggaaaagaatttgaattatgaagcggcttatagtgaactgacacaaattgcccaggaa atagaaactgaagctgtttctgtagatgtacttgccgaaaaagtaaaacgggcttccgaa ctgattgctttttgtcagacaaaattgaggtccactgagactgaagtcaacaaaattata aagcagatggaaaaccaacccttatag

DBGET integrated database retrieval system