Pedobacter cryoconitis: AY601_2495 Help Entry AY601_2495        CDS       T04341                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcm  Pedobacter cryoconitis Pathway pcm00998   Biosynthesis of various antibiotics pcm01100   Metabolic pathways pcm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AY601_2495    00074 Mycolic acid biosynthesis     AY601_2495   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AY601_2495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding EspB_PE Motif Other DBs NCBI-ProteinID:  AMP99384 UniProt:  A0A127VDK9 LinkDB All DBs Position 2968181..2968444 Genome browser AA seq 87 aa AA seqDB search MDREVIISAIKEVAAPYTQDKEALDQLSETTSFITDLKINSANLVDIVLDLEEKFGIEID NDSMAKMLDVKSTLDVIEAKLAEIDRQ NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggatagagaagttatcatttccgctattaaagaagttgcagcgccttatacgcaggac aaagaagcattagatcagcttagtgagaccacaagttttattacagacctgaaaatcaat tctgccaacctggttgatattgtactggacctggaagaaaagttcggcatagagatcgat aatgattctatggcaaaaatgctggatgtcaaatcaacactcgacgtcattgaagccaaa cttgctgaaattgataggcaatga

DBGET integrated database retrieval system