Pedobacter cryoconitis: AY601_3430 Help Entry AY601_3430        CDS       T04341                                  Name (GenBank) Elongation factor Tu   KO K03073   preprotein translocase subunit SecE Organism pcm  Pedobacter cryoconitis Pathway pcm02024   Quorum sensing pcm03060   Protein export pcm03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pcm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AY601_3430  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AY601_3430  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AY601_3430  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pcm02044]     AY601_3430 Secretion system [BR:pcm02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    AY601_3430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-ProteinID:  AMQ00296 UniProt:  A0A127VG48 LinkDB All DBs Position complement(4082390..4082587) Genome browser AA seq 65 aa AA seqDB search MASIVQFIKESYEEMTQKVTWPTWGELQNSAVLVLVASFIIAVVIFAMDKGSTFVLDTFY KSLSN NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggctagcatagttcaatttattaaagaatcgtatgaggaaatgacccagaaggttacc tggcctacatggggagaattgcaaaattctgcagtgctggttttggtagcttcgtttatt attgcagtggttatctttgcaatggataagggatctacttttgtgctagatactttttat aaatcactttctaattaa

DBGET integrated database retrieval system