Phanerochaete carnosa: PHACADRAFT_103144 Help Entry PHACADRAFT_103144 CDS       T03128                                  Name (RefSeq) hypothetical protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism pco  Phanerochaete carnosa Pathway pco03010   Ribosome pco04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pco00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     PHACADRAFT_103144   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     PHACADRAFT_103144  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pco03011]     PHACADRAFT_103144    04121 Ubiquitin system [BR:pco04121]     PHACADRAFT_103144   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pco04147]     PHACADRAFT_103144 Ribosome [BR:pco03011]  Ribosomal proteins   Eukaryotes    Small subunit     PHACADRAFT_103144   Archaea     PHACADRAFT_103144 Ubiquitin system [BR:pco04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    PHACADRAFT_103144 Exosome [BR:pco04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    PHACADRAFT_103144   Exosomal proteins of colorectal cancer cells    PHACADRAFT_103144 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_5 Dsc3_N Motif Other DBs NCBI-GeneID:  18907254 NCBI-ProteinID:  XP_007400336 JGI:  Phaca1_103144 UniProt:  K5VX52 LinkDB All DBs Position Unknown AA seq 83 aa AA seqDB search MISAHPVVYVKMLTGRTITLFSKLSSAVDELKRAIRVEENFTPDEQRLVFAGKQLNDSGR LVDHDVRNGSTLYLILRLNGGER NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgatctctgcgcaccccgtagtctacgttaagatgctcaccggcaggaccatcacactt tttagcaagctttcaagcgccgtggacgagcttaagcgtgcaatccgagtcgaggaaaat tttacgccggacgaacagcgcctcgtcttcgctgggaaacagctgaacgacagcgggcgt cttgtggaccatgatgtcaggaacggatcaacgctttatctaatcctacggctgaatggc ggagagcgc

DBGET integrated database retrieval system