Phanerochaete carnosa: PHACADRAFT_163521 Help Entry PHACADRAFT_163521 CDS       T03128                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism pco  Phanerochaete carnosa Pathway pco03060   Protein export pco04141   Protein processing in endoplasmic reticulum pco04145   Phagosome Brite KEGG Orthology (KO) [BR:pco00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     PHACADRAFT_163521    04141 Protein processing in endoplasmic reticulum     PHACADRAFT_163521  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     PHACADRAFT_163521  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pco04131]     PHACADRAFT_163521   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pco02044]     PHACADRAFT_163521 Membrane trafficking [BR:pco04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     PHACADRAFT_163521 Secretion system [BR:pco02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    PHACADRAFT_163521 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  18909252 NCBI-ProteinID:  XP_007397926 JGI:  Phaca1_163521 UniProt:  K5VP35 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MSDSESSRPVARPAASGVAKPPGAQVRRRAAGSTQVSKPNSTRAAGAGGSSNTMLKLYTD DSPGIRVDPFIVLVLSLSFIASIFFLHISAKIIRAFTK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctgactcagagtcgtcccgtcccgtcgctcgtccggccgcttctggcgttgccaaa ccgcccggtgcgcaggttcgccggcgagcagcaggctctactcaggtctccaagcccaac tcgacccgtgcggcaggtgctggtggttcctcaaacacgatgttgaagctgtacacagac gactcacctgggattcgagtcgacccctttattgtgcttgtcctctccctctctttcatt gcttccatcttcttccttcacatatcggccaagatcatccgcgctttcaccaaatag

DBGET integrated database retrieval system