Phanerochaete carnosa: PHACADRAFT_247860 Help Entry PHACADRAFT_247860 CDS       T03128                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism pco  Phanerochaete carnosa Pathway pco03060   Protein export pco04141   Protein processing in endoplasmic reticulum pco04145   Phagosome Brite KEGG Orthology (KO) [BR:pco00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     PHACADRAFT_247860    04141 Protein processing in endoplasmic reticulum     PHACADRAFT_247860  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     PHACADRAFT_247860  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pco04131]     PHACADRAFT_247860   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pco02044]     PHACADRAFT_247860 Membrane trafficking [BR:pco04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     PHACADRAFT_247860 Secretion system [BR:pco02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    PHACADRAFT_247860 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  18914199 NCBI-ProteinID:  XP_007390747 JGI:  Phaca1_247860 UniProt:  K5WQ40 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MSDKVKEFMEVPQEFVKEGQQFLIRCTKPSYKEFLQISKAVAVGFAVMGFIGYFVKLIHI PINNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaagtgaaagagtttatggaggtccctcaggagtttgtcaaggaaggccag cagttcctgatacgctgcacgaagccttcgtacaaggagttcctccagatctccaaggca gtagcagtaggcttcgccgtcatgggcttcattggttactttgtcaagctcatccacatc ccgataaacaatattctagttggtggtgcataa

DBGET integrated database retrieval system