Phanerochaete carnosa: PHACADRAFT_264942 Help Entry PHACADRAFT_264942 CDS       T03128                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism pco  Phanerochaete carnosa Pathway pco04145   Phagocytosis pco04517   IgSF CAM signaling pco04814   Motor proteins Brite KEGG Orthology (KO) [BR:pco00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PHACADRAFT_264942  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     PHACADRAFT_264942   09142 Cell motility    04814 Motor proteins     PHACADRAFT_264942  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pco03037]     PHACADRAFT_264942    04812 Cytoskeleton proteins [BR:pco04812]     PHACADRAFT_264942 Cilium and associated proteins [BR:pco03037]  Motile cilia and associated proteins   Dynein arm    PHACADRAFT_264942 Cytoskeleton proteins [BR:pco04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PHACADRAFT_264942 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  18918970 NCBI-ProteinID:  XP_007401513 JGI:  Phaca1_264942 UniProt:  K5VU88 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MSEKLDAPTSSEPSVINGAGPKAVIKNVDMSEEMQQEAVDVASVALEKYNIEKDIAAQIK KEFDRRHGPTWHVVVGKNFGSYVTHETKHFIYFYIGQLAILIWKS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgtccgagaaactcgacgccccgacctcgtccgagccatccgtcatcaacggcgccggc cccaaggccgtcatcaagaacgtcgacatgagcgaggagatgcagcaggaggccgtcgac gtcgcgtccgtcgcgctcgaaaagtacaacatcgaaaaggacatcgccgcccagatcaaa aaggagttcgaccgacgccacggcccaacctggcacgttgtcgtcggcaagaactttggc agctacgtcacacatgagacgaagcacttcatctacttctacatcggccagctcgcgatc ctcatctggaaatcataa

DBGET integrated database retrieval system