Phanerochaete carnosa: PHACADRAFT_266254 Help Entry PHACADRAFT_266254 CDS       T03128                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism pco  Phanerochaete carnosa Pathway pco03050   Proteasome pco03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pco00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     PHACADRAFT_266254   09124 Replication and repair    03440 Homologous recombination     PHACADRAFT_266254  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pco03019]     PHACADRAFT_266254    04131 Membrane trafficking [BR:pco04131]     PHACADRAFT_266254    03051 Proteasome [BR:pco03051]     PHACADRAFT_266254    03400 DNA repair and recombination proteins [BR:pco03400]     PHACADRAFT_266254 Messenger RNA biogenesis [BR:pco03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      PHACADRAFT_266254 Membrane trafficking [BR:pco04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     PHACADRAFT_266254 Proteasome [BR:pco03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      PHACADRAFT_266254 DNA repair and recombination proteins [BR:pco03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      PHACADRAFT_266254 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  18919348 NCBI-ProteinID:  XP_007402835 JGI:  Phaca1_266254 UniProt:  K5WEK8 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MSDKASSSKTEAAPPTKIIEPHKDDDHPAALGVLEEDDEFEEFPVADWDDSQTDLAHLGG AAPGAAKSGGDKLWEDNWDDDDVEDDFSVQLRNELAKKNGTDAMQH NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgtcagacaaggcatcctcatctaagacggaggcggccccgcctactaagatcatcgag cctcacaaggacgatgaccaccctgcagcacttggcgtactcgaggaggatgacgagttc gaggagttcccggtggcagactgggacgactcgcagacagacctcgcacacctcggcggc gctgctcccggagcggccaagtctggcggtgacaagctctgggaagataactgggatgat gacgacgtcgaggacgatttcagtgtgcaactaaggaacgagctcgcgaagaagaatggc accgatgcgatgcaacactag

DBGET integrated database retrieval system