Phanerochaete carnosa: PHACADRAFT_50904 Help Entry PHACADRAFT_50904  CDS       T03128                                  Name (RefSeq) hypothetical protein   KO K07897   Ras-related protein Rab-7A Organism pco  Phanerochaete carnosa Pathway pco04138   Autophagy - yeast pco04144   Endocytosis pco04145   Phagosome pco04148   Efferocytosis Brite KEGG Orthology (KO) [BR:pco00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     PHACADRAFT_50904    04145 Phagosome     PHACADRAFT_50904    04138 Autophagy - yeast     PHACADRAFT_50904    04148 Efferocytosis     PHACADRAFT_50904  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pco04131]     PHACADRAFT_50904   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pco04147]     PHACADRAFT_50904    04031 GTP-binding proteins [BR:pco04031]     PHACADRAFT_50904 Membrane trafficking [BR:pco04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     PHACADRAFT_50904 Exosome [BR:pco04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    PHACADRAFT_50904   Exosomal proteins of other body fluids (saliva and urine)    PHACADRAFT_50904   Exosomal proteins of colorectal cancer cells    PHACADRAFT_50904   Exosomal proteins of bladder cancer cells    PHACADRAFT_50904 GTP-binding proteins [BR:pco04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     PHACADRAFT_50904 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA AAA_22 RsgA_GTPase GTP_EFTU AAA_16 nSTAND1 PolyA_pol_arg_C AAA_24 Septin Motif Other DBs NCBI-GeneID:  18919945 NCBI-ProteinID:  XP_007389620 JGI:  Phaca1_50904 UniProt:  K5WMC9 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MRTLKLVVVGASGVGKTSLRNQYVSGRFTTGYRATIGADFITKSVPHHGNPDELVTLQIW DTAGQERFSSLSSAFFRGADAVLLMFDVNQPQTLEALRKWWDDFRDKAPVADDEVDSFCS VFVGNKID NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcgcacccttaagctcgttgttgtcggcgcgtcgggcgtcggcaagaccagcctccgc aaccagtatgtttcgggaaggttcacgacgggctatcgcgcgacgatcggcgcggatttc atcacgaagagcgtgccgcaccatggcaaccctgacgagctggtcacgctacagatctgg gataccgccggccaagaaaggttttcaagcctgtcatctgcattttttcgtggagcggat gcggtgttgctcatgttcgacgtgaaccagccgcaaacactagaggctctgcgcaaatgg tgggacgactttcgagacaaggcgccggtggcggacgatgaagtggatagcttctgctct gtattcgtaggcaacaagattgac

DBGET integrated database retrieval system