Phanerochaete carnosa: PHACADRAFT_71199 Help Entry PHACADRAFT_71199  CDS       T03128                                  Name (RefSeq) hypothetical protein   KO K25829   transcription elongation factor 1 Organism pco  Phanerochaete carnosa Brite KEGG Orthology (KO) [BR:pco00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pco03400]     PHACADRAFT_71199 DNA repair and recombination proteins [BR:pco03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      Other TCR factor       PHACADRAFT_71199 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_Elf1 zf-CHY Nup96 DpnI Motif Other DBs NCBI-GeneID:  18920270 NCBI-ProteinID:  XP_007395895 JGI:  Phaca1_71199 UniProt:  K5WYI7 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MGKRKKSSRKPTGPRRREPLESTFTCLFCHHDKSVSVRMDRKEGIAQLFCKVCDQRFQSK VNHLTEPIDIYSEWIDAADAAERQA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgggcaaacgcaaaaagtcatcccgcaagcctacaggtcctcgcagacgcgaacctttg gagtcgacgttcacctgcttgttctgccatcatgataaatctgtaagcgttcgcatggac cgaaaagagggcatcgcccagttgttctgcaaagtatgcgaccagcgattccagagcaag gttaaccacttgacggaaccaattgacatctactctgaatggatcgatgcggcggatgca gctgaaagacaagca

DBGET integrated database retrieval system