Pseudomonas coronafaciens pv. oryzae: POR16_01865 Help Entry POR16_01865       CDS       T08147                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcof  Pseudomonas coronafaciens pv. oryzae Pathway pcof00998   Biosynthesis of various antibiotics pcof01100   Metabolic pathways pcof01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcof00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     POR16_01865    00074 Mycolic acid biosynthesis     POR16_01865   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     POR16_01865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QGL55166 LinkDB All DBs Position complement(393241..393504) Genome browser AA seq 87 aa AA seqDB search MSDLHQDIKLLIIDALGLEDITPEDIGNDMTLFGEGLGLDSVDALELGLAIQKRYGIRID ADAKDTRNHFASVDSLAAFVSANRPEN NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccaggacattaaattgttgatcatcgatgccctgggcctcgaagac atcactccggaggatatcggcaacgatatgacgttgttcggcgaaggacttggcctggat tcggtcgatgcactggaattgggtctggccatccagaagcgctacggcatcaggatcgac gccgatgcaaaagacacacgtaaccattttgccagcgtcgacagcctagcggccttcgtc agcgccaaccggcctgagaattga

DBGET integrated database retrieval system