Segatella copri: LK433_14445 Help Entry LK433_14445       CDS       T07933                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcoi  Segatella copri Pathway pcoi00998   Biosynthesis of various antibiotics pcoi01100   Metabolic pathways pcoi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcoi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LK433_14445    00074 Mycolic acid biosynthesis     LK433_14445   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LK433_14445 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PH_DUOX Motif Other DBs NCBI-ProteinID:  UEA44406 LinkDB All DBs Position unnamed1:complement(115543..115779) Genome browser AA seq 78 aa AA seqDB search MDQNVINDVKRLAFEVLKDERIMTEENFNFMDAEKMDSVNRVAILVAIEKEYDFIFKLKE ISSWNTVMELAEIVEKKM NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggatcagaatgtaatcaatgacgtgaagcgtctcgctttcgaagtgctcaaggacgag cgaatcatgacagaagagaactttaattttatggacgcagagaagatggactctgtgaac cgtgtagcaatccttgtggctatcgagaaagaatatgacttcatcttcaaactgaaggaa atctcttcttggaataccgtaatggagcttgctgaaattgtagaaaagaaaatgtaa

DBGET integrated database retrieval system