Proteus columbae: F1325_17380 Help Entry F1325_17380       CDS       T06419                                  Name (GenBank) HU family DNA-binding protein   KO K05787   DNA-binding protein HU-alpha Organism pcol  Proteus columbae Brite KEGG Orthology (KO) [BR:pcol00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pcol03032]     F1325_17380    03036 Chromosome and associated proteins [BR:pcol03036]     F1325_17380    03400 DNA repair and recombination proteins [BR:pcol03400]     F1325_17380 DNA replication proteins [BR:pcol03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     F1325_17380 Chromosome and associated proteins [BR:pcol03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     F1325_17380 DNA repair and recombination proteins [BR:pcol03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       F1325_17380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 HU-DNA_bdg DUF2267 GTP_EFTU_D2 Motif Other DBs NCBI-ProteinID:  QHN12105 UniProt:  A0A6I7DBD3 LinkDB All DBs Position complement(3715068..3715340) Genome browser AA seq 90 aa AA seqDB search MNKAELTESVAEKADLTKTQAKAAIEAFIDSVTGALKEGDSVQLVGFGTFKVNHRAERTG RNPQTGKEIKIAAANVPAFTAGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagctgaattaaccgaatcagttgctgaaaaagcggatctgacaaaaactcaa gcaaaagctgctattgaagcgtttatcgattcagtaacaggtgctctgaaagaaggcgat tctgtacagttagttggtttcggtacattcaaggtgaatcaccgtgcagagcgtactggt cgtaaccctcaaactggtaaagaaattaaaattgcagcagctaacgttcctgcatttact gccggtaaagcactgaaagacgcagtaaaataa

DBGET integrated database retrieval system