Paracoccus contaminans: B0A89_04625 Help Entry B0A89_04625       CDS       T04876                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pcon  Paracoccus contaminans Brite KEGG Orthology (KO) [BR:pcon00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pcon03032]     B0A89_04625    03036 Chromosome and associated proteins [BR:pcon03036]     B0A89_04625    03400 DNA repair and recombination proteins [BR:pcon03400]     B0A89_04625 DNA replication proteins [BR:pcon03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     B0A89_04625 Chromosome and associated proteins [BR:pcon03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     B0A89_04625 DNA repair and recombination proteins [BR:pcon03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       B0A89_04625 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding DUF2267 SasG_E DUF5760 HU-HIG Ldi Motif Other DBs NCBI-ProteinID:  ARJ69021 UniProt:  A0A1W6CVZ3 LinkDB All DBs Position complement(963159..963464) Genome browser AA seq 101 aa AA seqDB search MAQAPANAKPMTKTQLVAALAEEMGGDKKAATAALDAIQAVVARTVTEGGSLTLPGIGKV GVRARPERQVRNPQTQEMMTKPADKVVKITIAKSLKDSVNA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcgcaagcccctgcgaatgccaagcccatgaccaaaacgcagctggtcgctgccctg gccgaagaaatgggcggcgacaagaaagccgcgaccgccgcgcttgacgcgatccaggcc gtcgtggcgcgcaccgtgaccgaaggcggatcgctgaccctgccggggatcggcaaggtg ggcgtgcgcgcgcggcccgaacgccaggtgcgcaacccgcagacgcaggaaatgatgacc aagcctgccgacaaggtcgtcaagatcacgatcgccaagtcgctcaaggacagcgtgaac gcctga

DBGET integrated database retrieval system