Paracoccus contaminans: B0A89_07100 Help Entry B0A89_07100       CDS       T04876                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcon  Paracoccus contaminans Pathway pcon01100   Metabolic pathways pcon01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcon00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B0A89_07100    00074 Mycolic acid biosynthesis     B0A89_07100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B0A89_07100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ARJ69429 UniProt:  A0A1W6CXC4 LinkDB All DBs Position 1517044..1517280 Genome browser AA seq 78 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVTETASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIEGATA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgatcgcgtgaagaagatcgtcgtcgagcatctgggcgtcgaagaa gacaaagtgaccgaaaccgcctcgttcatcgacgacctgggggcggattcgctggacacc gtggaactggtcatggcgttcgaggaagagttcggcatcgagattcccgacgatgcggcc gagacgatccagaccttcggcgatgcggtcaagttcatcgagggcgcgaccgcctga

DBGET integrated database retrieval system