Puma concolor (puma): 112848478 Help Entry 112848478         CDS       T08890                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism pcoo  Puma concolor (puma) Pathway pcoo01521   EGFR tyrosine kinase inhibitor resistance pcoo01522   Endocrine resistance pcoo04010   MAPK signaling pathway pcoo04012   ErbB signaling pathway pcoo04014   Ras signaling pathway pcoo04015   Rap1 signaling pathway pcoo04062   Chemokine signaling pathway pcoo04068   FoxO signaling pathway pcoo04071   Sphingolipid signaling pathway pcoo04072   Phospholipase D signaling pathway pcoo04137   Mitophagy - animal pcoo04140   Autophagy - animal pcoo04150   mTOR signaling pathway pcoo04151   PI3K-Akt signaling pathway pcoo04210   Apoptosis pcoo04211   Longevity regulating pathway pcoo04213   Longevity regulating pathway - multiple species pcoo04218   Cellular senescence pcoo04360   Axon guidance pcoo04370   VEGF signaling pathway pcoo04371   Apelin signaling pathway pcoo04540   Gap junction pcoo04550   Signaling pathways regulating pluripotency of stem cells pcoo04625   C-type lectin receptor signaling pathway pcoo04650   Natural killer cell mediated cytotoxicity pcoo04660   T cell receptor signaling pathway pcoo04662   B cell receptor signaling pathway pcoo04664   Fc epsilon RI signaling pathway pcoo04714   Thermogenesis pcoo04720   Long-term potentiation pcoo04722   Neurotrophin signaling pathway pcoo04725   Cholinergic synapse pcoo04726   Serotonergic synapse pcoo04730   Long-term depression pcoo04810   Regulation of actin cytoskeleton pcoo04910   Insulin signaling pathway pcoo04912   GnRH signaling pathway pcoo04915   Estrogen signaling pathway pcoo04916   Melanogenesis pcoo04917   Prolactin signaling pathway pcoo04919   Thyroid hormone signaling pathway pcoo04921   Oxytocin signaling pathway pcoo04926   Relaxin signaling pathway pcoo04929   GnRH secretion pcoo04933   AGE-RAGE signaling pathway in diabetic complications pcoo04935   Growth hormone synthesis, secretion and action pcoo05010   Alzheimer disease pcoo05022   Pathways of neurodegeneration - multiple diseases pcoo05034   Alcoholism pcoo05160   Hepatitis C pcoo05161   Hepatitis B pcoo05163   Human cytomegalovirus infection pcoo05165   Human papillomavirus infection pcoo05166   Human T-cell leukemia virus 1 infection pcoo05167   Kaposi sarcoma-associated herpesvirus infection pcoo05170   Human immunodeficiency virus 1 infection pcoo05200   Pathways in cancer pcoo05203   Viral carcinogenesis pcoo05205   Proteoglycans in cancer pcoo05206   MicroRNAs in cancer pcoo05207   Chemical carcinogenesis - receptor activation pcoo05208   Chemical carcinogenesis - reactive oxygen species pcoo05210   Colorectal cancer pcoo05211   Renal cell carcinoma pcoo05213   Endometrial cancer pcoo05214   Glioma pcoo05215   Prostate cancer pcoo05216   Thyroid cancer pcoo05218   Melanoma pcoo05219   Bladder cancer pcoo05220   Chronic myeloid leukemia pcoo05221   Acute myeloid leukemia pcoo05223   Non-small cell lung cancer pcoo05224   Breast cancer pcoo05225   Hepatocellular carcinoma pcoo05226   Gastric cancer pcoo05230   Central carbon metabolism in cancer pcoo05231   Choline metabolism in cancer pcoo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcoo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112848478 (NRAS)    04012 ErbB signaling pathway     112848478 (NRAS)    04014 Ras signaling pathway     112848478 (NRAS)    04015 Rap1 signaling pathway     112848478 (NRAS)    04370 VEGF signaling pathway     112848478 (NRAS)    04371 Apelin signaling pathway     112848478 (NRAS)    04068 FoxO signaling pathway     112848478 (NRAS)    04072 Phospholipase D signaling pathway     112848478 (NRAS)    04071 Sphingolipid signaling pathway     112848478 (NRAS)    04151 PI3K-Akt signaling pathway     112848478 (NRAS)    04150 mTOR signaling pathway     112848478 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112848478 (NRAS)    04137 Mitophagy - animal     112848478 (NRAS)   09143 Cell growth and death    04210 Apoptosis     112848478 (NRAS)    04218 Cellular senescence     112848478 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     112848478 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     112848478 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112848478 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112848478 (NRAS)    04650 Natural killer cell mediated cytotoxicity     112848478 (NRAS)    04660 T cell receptor signaling pathway     112848478 (NRAS)    04662 B cell receptor signaling pathway     112848478 (NRAS)    04664 Fc epsilon RI signaling pathway     112848478 (NRAS)    04062 Chemokine signaling pathway     112848478 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     112848478 (NRAS)    04929 GnRH secretion     112848478 (NRAS)    04912 GnRH signaling pathway     112848478 (NRAS)    04915 Estrogen signaling pathway     112848478 (NRAS)    04917 Prolactin signaling pathway     112848478 (NRAS)    04921 Oxytocin signaling pathway     112848478 (NRAS)    04926 Relaxin signaling pathway     112848478 (NRAS)    04935 Growth hormone synthesis, secretion and action     112848478 (NRAS)    04919 Thyroid hormone signaling pathway     112848478 (NRAS)    04916 Melanogenesis     112848478 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     112848478 (NRAS)    04726 Serotonergic synapse     112848478 (NRAS)    04720 Long-term potentiation     112848478 (NRAS)    04730 Long-term depression     112848478 (NRAS)    04722 Neurotrophin signaling pathway     112848478 (NRAS)   09158 Development and regeneration    04360 Axon guidance     112848478 (NRAS)   09149 Aging    04211 Longevity regulating pathway     112848478 (NRAS)    04213 Longevity regulating pathway - multiple species     112848478 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     112848478 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112848478 (NRAS)    05206 MicroRNAs in cancer     112848478 (NRAS)    05205 Proteoglycans in cancer     112848478 (NRAS)    05207 Chemical carcinogenesis - receptor activation     112848478 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     112848478 (NRAS)    05203 Viral carcinogenesis     112848478 (NRAS)    05230 Central carbon metabolism in cancer     112848478 (NRAS)    05231 Choline metabolism in cancer     112848478 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112848478 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     112848478 (NRAS)    05225 Hepatocellular carcinoma     112848478 (NRAS)    05226 Gastric cancer     112848478 (NRAS)    05214 Glioma     112848478 (NRAS)    05216 Thyroid cancer     112848478 (NRAS)    05221 Acute myeloid leukemia     112848478 (NRAS)    05220 Chronic myeloid leukemia     112848478 (NRAS)    05218 Melanoma     112848478 (NRAS)    05211 Renal cell carcinoma     112848478 (NRAS)    05219 Bladder cancer     112848478 (NRAS)    05215 Prostate cancer     112848478 (NRAS)    05213 Endometrial cancer     112848478 (NRAS)    05224 Breast cancer     112848478 (NRAS)    05223 Non-small cell lung cancer     112848478 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112848478 (NRAS)    05170 Human immunodeficiency virus 1 infection     112848478 (NRAS)    05161 Hepatitis B     112848478 (NRAS)    05160 Hepatitis C     112848478 (NRAS)    05163 Human cytomegalovirus infection     112848478 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     112848478 (NRAS)    05165 Human papillomavirus infection     112848478 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     112848478 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     112848478 (NRAS)   09165 Substance dependence    05034 Alcoholism     112848478 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112848478 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     112848478 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     112848478 (NRAS)    01522 Endocrine resistance     112848478 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcoo04131]     112848478 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcoo04147]     112848478 (NRAS)    04031 GTP-binding proteins [BR:pcoo04031]     112848478 (NRAS) Membrane trafficking [BR:pcoo04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     112848478 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     112848478 (NRAS) Exosome [BR:pcoo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112848478 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    112848478 (NRAS)   Exosomal proteins of breast cancer cells    112848478 (NRAS)   Exosomal proteins of colorectal cancer cells    112848478 (NRAS) GTP-binding proteins [BR:pcoo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112848478 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  112848478 NCBI-ProteinID:  XP_025767991 UniProt:  A0A6P6GXY2 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctggt caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt aagcgagtaaaagactccgatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggaccgtcgacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system