Puma concolor (puma): 112849669 Help Entry 112849669         CDS       T08890                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism pcoo  Puma concolor (puma) Pathway pcoo04015   Rap1 signaling pathway pcoo04810   Regulation of actin cytoskeleton pcoo05014   Amyotrophic lateral sclerosis pcoo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112849669 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112849669 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112849669 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112849669 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcoo04131]     112849669 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pcoo04812]     112849669 (PFN2)    04147 Exosome [BR:pcoo04147]     112849669 (PFN2) Membrane trafficking [BR:pcoo04131]  Others   Actin-binding proteins    Others     112849669 (PFN2) Cytoskeleton proteins [BR:pcoo04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112849669 (PFN2) Exosome [BR:pcoo04147]  Exosomal proteins   Proteins found in most exosomes    112849669 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112849669 NCBI-ProteinID:  XP_025769141 UniProt:  A0A6P6H147 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system