Puma concolor (puma): 112849717 Help Entry 112849717         CDS       T08890                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism pcoo  Puma concolor (puma) Pathway pcoo04060   Cytokine-cytokine receptor interaction pcoo04620   Toll-like receptor signaling pathway pcoo04622   RIG-I-like receptor signaling pathway pcoo04625   C-type lectin receptor signaling pathway pcoo04630   JAK-STAT signaling pathway pcoo04658   Th1 and Th2 cell differentiation pcoo04936   Alcoholic liver disease pcoo04940   Type I diabetes mellitus pcoo05133   Pertussis pcoo05134   Legionellosis pcoo05140   Leishmaniasis pcoo05142   Chagas disease pcoo05143   African trypanosomiasis pcoo05144   Malaria pcoo05145   Toxoplasmosis pcoo05146   Amoebiasis pcoo05152   Tuberculosis pcoo05162   Measles pcoo05164   Influenza A pcoo05168   Herpes simplex virus 1 infection pcoo05171   Coronavirus disease - COVID-19 pcoo05200   Pathways in cancer pcoo05321   Inflammatory bowel disease pcoo05330   Allograft rejection pcoo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112849717 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112849717 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112849717 (IL12A)    04622 RIG-I-like receptor signaling pathway     112849717 (IL12A)    04625 C-type lectin receptor signaling pathway     112849717 (IL12A)    04658 Th1 and Th2 cell differentiation     112849717 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112849717 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     112849717 (IL12A)    05164 Influenza A     112849717 (IL12A)    05162 Measles     112849717 (IL12A)    05168 Herpes simplex virus 1 infection     112849717 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     112849717 (IL12A)    05134 Legionellosis     112849717 (IL12A)    05152 Tuberculosis     112849717 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     112849717 (IL12A)    05144 Malaria     112849717 (IL12A)    05145 Toxoplasmosis     112849717 (IL12A)    05140 Leishmaniasis     112849717 (IL12A)    05142 Chagas disease     112849717 (IL12A)    05143 African trypanosomiasis     112849717 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     112849717 (IL12A)    05330 Allograft rejection     112849717 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112849717 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112849717 (IL12A)    04936 Alcoholic liver disease     112849717 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcoo04052]     112849717 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:pcoo00536]     112849717 (IL12A) Cytokines and neuropeptides [BR:pcoo04052]  Cytokines   Interleukins    112849717 (IL12A) Glycosaminoglycan binding proteins [BR:pcoo00536]  Heparan sulfate / Heparin   Cytokines    112849717 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 KASH_SINE4 DUF6482 DUF5952 Motif Other DBs NCBI-GeneID:  112849717 NCBI-ProteinID:  XP_025769194 UniProt:  A0A6P6H0J6 LinkDB All DBs Position Unknown AA seq 222 aa AA seqDB search MCPPRGLLLVTILVLLNHLDHLSLARNLPTPTPSPGMFQCLNHSQTLLRAISNTLQKARQ TLEFYSCTSEEIDHEDITKDKTSTVEACLPLELTMNESCLASREISLITNGSCLASRKTS FMTTLCLSSIYEDLKMYQVEFKAMNAKLLMDPKRQIFLDQNMLTAIDELLQALNVNSVTV PQNSSLEEPDFYKTKIKLCILLHAFRIRAVTINRMMSYLNSS NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgtgcccgccgcgtggcctcctccttgtaaccatcctggtcctgttaaaccacctggac cacctcagtttggccaggaacctccccacacccacaccaagcccaggaatgttccagtgc ctcaaccactcccaaaccctgctgcgagccatcagcaacacgcttcagaaggccagacaa actctagaattttactcctgcacttccgaagagattgatcatgaagatatcacaaaagat aaaaccagcacagtggaggcctgcttaccactggaattaaccatgaatgagagttgcctg gcttccagagagatctctctgataactaatgggagttgcctggcctccagaaagacctct tttatgacgaccctgtgtcttagcagtatctatgaggacttaaagatgtaccaggtggag ttcaaggccatgaatgcaaagctgttaatggatcctaaaaggcagatctttctggatcaa aacatgctgacagctattgatgagctgttacaggccctgaatgtcaacagtgtgactgtg ccacagaactcctccctggaagaaccggatttttataaaactaaaatcaagctctgcata cttcttcatgctttcagaattcgtgcagtgaccatcaatagaatgatgagctatctgaat tcttcctaa

DBGET integrated database retrieval system