KEGG   Puma concolor (puma): 112852203
Entry
112852203         CDS       T08890                                 
Symbol
RPS6KB1
Name
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
pcoo  Puma concolor (puma)
Pathway
pcoo01521  EGFR tyrosine kinase inhibitor resistance
pcoo01522  Endocrine resistance
pcoo04012  ErbB signaling pathway
pcoo04066  HIF-1 signaling pathway
pcoo04140  Autophagy - animal
pcoo04150  mTOR signaling pathway
pcoo04151  PI3K-Akt signaling pathway
pcoo04152  AMPK signaling pathway
pcoo04211  Longevity regulating pathway
pcoo04213  Longevity regulating pathway - multiple species
pcoo04350  TGF-beta signaling pathway
pcoo04371  Apelin signaling pathway
pcoo04666  Fc gamma R-mediated phagocytosis
pcoo04714  Thermogenesis
pcoo04910  Insulin signaling pathway
pcoo04931  Insulin resistance
pcoo05163  Human cytomegalovirus infection
pcoo05165  Human papillomavirus infection
pcoo05170  Human immunodeficiency virus 1 infection
pcoo05200  Pathways in cancer
pcoo05205  Proteoglycans in cancer
pcoo05207  Chemical carcinogenesis - receptor activation
pcoo05210  Colorectal cancer
pcoo05212  Pancreatic cancer
pcoo05221  Acute myeloid leukemia
pcoo05224  Breast cancer
pcoo05225  Hepatocellular carcinoma
pcoo05226  Gastric cancer
pcoo05231  Choline metabolism in cancer
pcoo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcoo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112852203 (RPS6KB1)
   04350 TGF-beta signaling pathway
    112852203 (RPS6KB1)
   04371 Apelin signaling pathway
    112852203 (RPS6KB1)
   04066 HIF-1 signaling pathway
    112852203 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    112852203 (RPS6KB1)
   04152 AMPK signaling pathway
    112852203 (RPS6KB1)
   04150 mTOR signaling pathway
    112852203 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112852203 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    112852203 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112852203 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    112852203 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    112852203 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    112852203 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112852203 (RPS6KB1)
   05205 Proteoglycans in cancer
    112852203 (RPS6KB1)
   05207 Chemical carcinogenesis - receptor activation
    112852203 (RPS6KB1)
   05231 Choline metabolism in cancer
    112852203 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112852203 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112852203 (RPS6KB1)
   05212 Pancreatic cancer
    112852203 (RPS6KB1)
   05225 Hepatocellular carcinoma
    112852203 (RPS6KB1)
   05226 Gastric cancer
    112852203 (RPS6KB1)
   05221 Acute myeloid leukemia
    112852203 (RPS6KB1)
   05224 Breast cancer
    112852203 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112852203 (RPS6KB1)
   05163 Human cytomegalovirus infection
    112852203 (RPS6KB1)
   05165 Human papillomavirus infection
    112852203 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112852203 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112852203 (RPS6KB1)
   01522 Endocrine resistance
    112852203 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcoo01001]
    112852203 (RPS6KB1)
Enzymes [BR:pcoo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112852203 (RPS6KB1)
Protein kinases [BR:pcoo01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   112852203 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal ABC1 DUF1015
Other DBs
NCBI-GeneID: 112852203
NCBI-ProteinID: XP_025771500
UniProt: A0A6P6H6Z7
LinkDB
Position
Unknown
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
VEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatttcggaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacggaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagaaggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgctaaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaggaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggatgctggagaagttcaagctcatccattcttcaggcatattaattgggaagaactg
ctggctaggaaggtggaacccccttttaaacctctgttgcaatctgaggaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgttgctccatctgtacttgaa
agtgtgaaagaaaaattttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacagcaaatcctcagacacctgtggaatatccaatggaaacaagtgga
gtagagcagatggatgtgacgatgagtggggaagcttcagcaccacttcccatacgacag
ccgaactctgggccatacaaaaaacaagcttttcccatgatctccaaacgaccagagcac
ctacgtatgaatctatga

DBGET integrated database retrieval system