KEGG Orthology (KO) [BR:pcoo00001]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00760 Nicotinate and nicotinamide metabolism
112852540 (SIRT6)
09150 Organismal Systems
09159 Environmental adaptation
04714 Thermogenesis
112852540 (SIRT6)
09160 Human Diseases
09161 Cancer: overview
05230 Central carbon metabolism in cancer
112852540 (SIRT6)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:pcoo03036]
112852540 (SIRT6)
Enzymes [BR:pcoo01000]
2. Transferases
2.3 Acyltransferases
2.3.1 Transferring groups other than aminoacyl groups
2.3.1.286 protein acetyllysine N-acetyltransferase
112852540 (SIRT6)
Chromosome and associated proteins [BR:pcoo03036]
Eukaryotic type
Histone modification proteins
HDACs (histone deacetylases)
SIRTs (sirtuins, class III HDACs)
112852540 (SIRT6)
178 aa
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVRELAQLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTKTHMALVQLERVGLLCFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGSMGLKATGRLCTVAKARGLRACR