Puma concolor (puma): 112852617 Help Entry 112852617         CDS       T08890                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism pcoo  Puma concolor (puma) Pathway pcoo04140   Autophagy - animal pcoo04144   Endocytosis pcoo04152   AMPK signaling pathway pcoo04530   Tight junction pcoo04972   Pancreatic secretion pcoo05014   Amyotrophic lateral sclerosis pcoo05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     112852617 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112852617 (RAB8A)    04140 Autophagy - animal     112852617 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     112852617 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     112852617 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112852617 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     112852617 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcoo04131]     112852617 (RAB8A)    03036 Chromosome and associated proteins [BR:pcoo03036]     112852617 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcoo04147]     112852617 (RAB8A)    04031 GTP-binding proteins [BR:pcoo04031]     112852617 (RAB8A) Membrane trafficking [BR:pcoo04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     112852617 (RAB8A)  Autophagy   Other autophagy associated proteins     112852617 (RAB8A) Chromosome and associated proteins [BR:pcoo03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     112852617 (RAB8A) Exosome [BR:pcoo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112852617 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    112852617 (RAB8A)   Exosomal proteins of colorectal cancer cells    112852617 (RAB8A) GTP-binding proteins [BR:pcoo04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     112852617 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  112852617 NCBI-ProteinID:  XP_025771922 UniProt:  A0A6P6H8D4 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSSQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgcgttcaactcaactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacggcctactacaggggc gcaatgggcatcatgctggtctatgacatcaccaacgagaaatcctttgacaacatccgg aactggattcggaatattgaggagcatgcttctgcagatgtcgaaaagatgatactcggg aacaagtgtgacgtgaacgacaagagacaagtgtccaaggaacggggagagaagctcgcc ctggactatggaatcaagttcatggagaccagtgcaaaggccaacatcaacgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaactggaaggcaac agtccccaagggagcagccagggagtcaaaatcaccccagaccagcagaagagaagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system