Puma concolor (puma): 112853046 Help Entry 112853046         CDS       T08890                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism pcoo  Puma concolor (puma) Pathway pcoo04014   Ras signaling pathway pcoo04015   Rap1 signaling pathway pcoo04022   cGMP-PKG signaling pathway pcoo04024   cAMP signaling pathway pcoo04062   Chemokine signaling pathway pcoo04071   Sphingolipid signaling pathway pcoo04072   Phospholipase D signaling pathway pcoo04081   Hormone signaling pcoo04144   Endocytosis pcoo04150   mTOR signaling pathway pcoo04270   Vascular smooth muscle contraction pcoo04310   Wnt signaling pathway pcoo04350   TGF-beta signaling pathway pcoo04360   Axon guidance pcoo04510   Focal adhesion pcoo04517   IgSF CAM signaling pcoo04519   Cadherin signaling pcoo04520   Adherens junction pcoo04530   Tight junction pcoo04611   Platelet activation pcoo04621   NOD-like receptor signaling pathway pcoo04625   C-type lectin receptor signaling pathway pcoo04660   T cell receptor signaling pathway pcoo04670   Leukocyte transendothelial migration pcoo04722   Neurotrophin signaling pathway pcoo04810   Regulation of actin cytoskeleton pcoo04921   Oxytocin signaling pathway pcoo04928   Parathyroid hormone synthesis, secretion and action pcoo04972   Pancreatic secretion pcoo05100   Bacterial invasion of epithelial cells pcoo05132   Salmonella infection pcoo05133   Pertussis pcoo05135   Yersinia infection pcoo05152   Tuberculosis pcoo05163   Human cytomegalovirus infection pcoo05200   Pathways in cancer pcoo05203   Viral carcinogenesis pcoo05205   Proteoglycans in cancer pcoo05206   MicroRNAs in cancer pcoo05210   Colorectal cancer pcoo05417   Lipid and atherosclerosis pcoo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112853046 (RHOA)    04015 Rap1 signaling pathway     112853046 (RHOA)    04310 Wnt signaling pathway     112853046 (RHOA)    04350 TGF-beta signaling pathway     112853046 (RHOA)    04072 Phospholipase D signaling pathway     112853046 (RHOA)    04071 Sphingolipid signaling pathway     112853046 (RHOA)    04024 cAMP signaling pathway     112853046 (RHOA)    04022 cGMP-PKG signaling pathway     112853046 (RHOA)    04150 mTOR signaling pathway     112853046 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     112853046 (RHOA)    04517 IgSF CAM signaling     112853046 (RHOA)    04519 Cadherin signaling     112853046 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112853046 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     112853046 (RHOA)    04520 Adherens junction     112853046 (RHOA)    04530 Tight junction     112853046 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112853046 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     112853046 (RHOA)    04621 NOD-like receptor signaling pathway     112853046 (RHOA)    04625 C-type lectin receptor signaling pathway     112853046 (RHOA)    04660 T cell receptor signaling pathway     112853046 (RHOA)    04670 Leukocyte transendothelial migration     112853046 (RHOA)    04062 Chemokine signaling pathway     112853046 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     112853046 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     112853046 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     112853046 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     112853046 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     112853046 (RHOA)   09158 Development and regeneration    04360 Axon guidance     112853046 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112853046 (RHOA)    05206 MicroRNAs in cancer     112853046 (RHOA)    05205 Proteoglycans in cancer     112853046 (RHOA)    05203 Viral carcinogenesis     112853046 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     112853046 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     112853046 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     112853046 (RHOA)    05135 Yersinia infection     112853046 (RHOA)    05133 Pertussis     112853046 (RHOA)    05152 Tuberculosis     112853046 (RHOA)    05100 Bacterial invasion of epithelial cells     112853046 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112853046 (RHOA)    05418 Fluid shear stress and atherosclerosis     112853046 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcoo04131]     112853046 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcoo04147]     112853046 (RHOA)    04031 GTP-binding proteins [BR:pcoo04031]     112853046 (RHOA) Membrane trafficking [BR:pcoo04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     112853046 (RHOA) Exosome [BR:pcoo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112853046 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    112853046 (RHOA)   Exosomal proteins of colorectal cancer cells    112853046 (RHOA)   Exosomal proteins of bladder cancer cells    112853046 (RHOA) GTP-binding proteins [BR:pcoo04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     112853046 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  112853046 NCBI-ProteinID:  XP_025772395 UniProt:  A0A6P6H9G6 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtcttcagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcacttctgtcccaatgtgcccatcattctggttggaaacaagaaggat cttcggaatgatgagcacacaaggcgggagctggccaagatgaagcaggagccggtgaaa ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacaagagccgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system